PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G1083
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 309aa    MW: 33489.4 Da    PI: 10.4302
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G1083genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.61.3e-4125101278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  C v+gC+adls++++yhrrhkvCevhsk+p+v ++g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Gh_A03G1083  25 CLVDGCTADLSKCRDYHRRHKVCEVHSKTPKVSIRGQEQRFCQQCSRFHSLVEFDEGKRSCRKRLDGHNRRRRKPQP 101
                  **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-341986IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.2312299IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.85E-3923104IPR004333Transcription factor, SBP-box
PfamPF031101.3E-302598IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MESAPSSASF KRARPPGFGN QGPSCLVDGC TADLSKCRDY HRRHKVCEVH SKTPKVSIRG  60
QEQRFCQQCS RFHSLVEFDE GKRSCRKRLD GHNRRRRKPQ PNALTVNSGS LLSNPPGSRY  120
LLFSGPQIFS TKSMTDSSTG AVKVKIDRSS SLNFSSRNSS FVGASSLNYK GERQFSFLQS  180
ANSSHPGVSV CQPLVNANPS PGNGGITQKM LLNGLNRTVE SNRALSLLSS QPAETREISL  240
SPMVQSGSTS SLIPNLQYKG LGMEGEQVGT ILATDQNTNT DLHGNGVFRT GHPGSSASGT  300
HHTLTFSWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-3025981184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18198KRSCRKRLDGHNRRRRKP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223290.0KJ622329.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL21) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479105.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_012479106.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_012479107.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_012479108.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_012479109.10.0PREDICTED: squamosa promoter-binding-like protein 16
SwissprotQ49I578e-59TGA1B_MAIZE; Teosinte glume architecture 1
TrEMBLA0A0B0NQP40.0A0A0B0NQP4_G
STRINGPOPTR_0003s16780.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-49SBP family protein